PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.B00301.1.p
Common NameEUGRSUZ_B00301, LOC104434288
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 438aa    MW: 49785.7 Da    PI: 5.3622
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.B00301.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.41.9e-19183229148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g WTteEd ll+++v+q+G + W+ Ia++++ gR +kqc++rw+++l
  Eucgr.B00301.1.p 183 KGQWTTEEDRLLIQLVEQFGLRKWSHIAQMLP-GRIGKQCRERWHNHL 229
                       799*****************************.*************97 PP

2Myb_DNA-binding56.75.4e-18235277145
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       ++ W++eEd++l++a+ + G++ W+ Ia++++ gRt++++k++w+
  Eucgr.B00301.1.p 235 KDTWSEEEDKILIRAHSEIGNK-WAEIAKRLP-GRTENSIKNHWN 277
                       679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.991178233IPR017930Myb domain
SuperFamilySSF466895.39E-32180276IPR009057Homeodomain-like
SMARTSM007176.1E-18182231IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-26184234IPR009057Homeodomain-like
CDDcd001671.60E-16186229No hitNo description
PfamPF139214.3E-19186243No hitNo description
SMARTSM007172.6E-17234282IPR001005SANT/Myb domain
PROSITE profilePS5129421.781234284IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-22235282IPR009057Homeodomain-like
CDDcd001671.00E-13237280No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010183Biological Processpollen tube guidance
GO:0045697Biological Processregulation of synergid differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 438 aa     Download sequence    Send to blast
MDFHSKLDED FASHQTYLSD NCIKPCMRNR ETAFGTVSST KGNFLQDFNH IDQFYIGESS  60
SNHALNKQTA SFDPFDLYPY KVFTDLDVYE DKPFAENGGH GLVMDNFQVE GSLMAVTTAN  120
IMNESGRSHM LGDYHQDIKP VSFVVPDEVS CISAGNGYYK KSLVNKSKAS SSRRTRKRPH  180
VIKGQWTTEE DRLLIQLVEQ FGLRKWSHIA QMLPGRIGKQ CRERWHNHLR PDIKKDTWSE  240
EEDKILIRAH SEIGNKWAEI AKRLPGRTEN SIKNHWNATK RRQYSKRKCR SKYPRASLLQ  300
DYIKSLNLSA SAKNPRKSSA GSGDCAIVAN DDDDASSSNP TSDEPRLEIM DFCSGDRLVP  360
NFEFDEVPEL SFDDKLFQEG CTIDSLLEDL PCPPDATHVS DEGYGMEMLD MDPLMEPDEE  420
PKKDLDLVEM MSQVNTL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-461812832104C-Myb DNA-Binding Domain
1msf_C1e-461812832104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00442DAPTransfer from AT4G18770Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.B00301.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010045549.10.0PREDICTED: transcription factor MYB98-like
SwissprotQ9S7L21e-100MYB98_ARATH; Transcription factor MYB98
TrEMBLA0A059CY290.0A0A059CY29_EUCGR; Uncharacterized protein
STRINGVIT_17s0000g08550.t011e-140(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58692847
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.17e-96myb domain protein 98